Lineage for d2aczd1 (2acz D:3-115)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629948Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 2630045Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) (S)
    two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains
  5. 2630065Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins)
    consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups
  6. 2630134Protein Succinate dehydrogenase subunit SdhD [82872] (1 species)
    membrane anchor protein
  7. 2630135Species Escherichia coli [TaxId:562] [82873] (7 PDB entries)
  8. 2630150Domain d2aczd1: 2acz D:3-115 [126567]
    Other proteins in same PDB: d2aczb1, d2aczb2, d2aczc_
    automatically matched to d1nekd_
    complexed with at5, cdn, f3s, fad, fes, heb, oaa, sf4

Details for d2aczd1

PDB Entry: 2acz (more details), 3.1 Å

PDB Description: Complex II (Succinate Dehydrogenase) From E. Coli with Atpenin A5 inhibitor co-crystallized at the ubiquinone binding site
PDB Compounds: (D:) Succinate dehydrogenase hydrophobic membrane anchor protein

SCOPe Domain Sequences for d2aczd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aczd1 f.21.2.2 (D:3-115) Succinate dehydrogenase subunit SdhD {Escherichia coli [TaxId: 562]}
snasalgrngvhdfilvrataivltlyiiymvgffatsgeltyevwigffasaftkvftl
lalfsilihawigmwqvltdyvkplalrlmlqlvivvalvvyviygfvvvwgv

SCOPe Domain Coordinates for d2aczd1:

Click to download the PDB-style file with coordinates for d2aczd1.
(The format of our PDB-style files is described here.)

Timeline for d2aczd1: