SCOPe 2.03: Domain d2aczd1: 2acz D:3-115

Lineage for d2aczd1 (2acz D:3-115)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families)
   two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains

5. Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (4 proteins)
   consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups

6. Protein Succinate dehydrogenase subunit SdhD [82872] (1 species)
   membrane anchor protein

7. Species Escherichia coli [TaxId:562] [82873] (6 PDB entries)

8. Domain d2aczd1: 2acz D:3-115 [126567]
   Other proteins in same PDB: d2aczb1, d2aczb2, d2aczc1
   automatically matched to d1nekd_
   complexed with at5, cdn, f3s, fad, fes, heb, oaa, sf4

Details for d2aczd1

PDB Entry: 2acz, 3.1 Å

PDB Description: Complex II (Succinate Dehydrogenase) From E. Coli with Atpenin A5 inhibitor co-crystallized at the ubiquinone binding site

PDB Compounds: (D:) Succinate dehydrogenase hydrophobic membrane anchor protein

SCOPe Domain Sequences for d2aczd1:

Sequence; same for both SEQRES and ATOM records:

>d2aczd1 f.21.2.2 (D:3-115) Succinate dehydrogenase subunit SdhD {Escherichia coli [TaxId: 562]}
snasalgrngvhdfilvrataivltlyiiymvgffatsgeltyevwigffasaftkvftl
lalfsilihawigmwqvltdyvkplalrlmlqlvivvalvvyviygfvvvwgv

Timeline for d2aczd1:

• d2aczd1 first appeared in SCOP 1.73
  
• d2aczd1 appears in SCOPe 2.02
  
• d2aczd1 appears in SCOPe 2.04
  
• d2aczd1 appears in the current release, SCOPe 2.08