| Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
| Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) ![]() two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains |
| Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (4 proteins) consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups |
| Protein Succinate dehydrogenase subunit SdhD [82872] (1 species) membrane anchor protein |
| Species Escherichia coli [TaxId:562] [82873] (6 PDB entries) |
| Domain d2aczd1: 2acz D:3-115 [126567] Other proteins in same PDB: d2aczb1, d2aczb2, d2aczc1 automatically matched to d1nekd_ complexed with at5, cdn, f3s, fad, fes, heb, oaa, sf4 |
PDB Entry: 2acz (more details), 3.1 Å
SCOPe Domain Sequences for d2aczd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aczd1 f.21.2.2 (D:3-115) Succinate dehydrogenase subunit SdhD {Escherichia coli [TaxId: 562]}
snasalgrngvhdfilvrataivltlyiiymvgffatsgeltyevwigffasaftkvftl
lalfsilihawigmwqvltdyvkplalrlmlqlvivvalvvyviygfvvvwgv
Timeline for d2aczd1: