Lineage for d2aczb1 (2acz B:107-238)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1979697Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) (S)
    contains two Fe4-S4 clusters
  5. 1979698Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)
  6. 1979758Protein automated matches [231469] (4 species)
    not a true protein
  7. 1979764Species Escherichia coli [TaxId:562] [231470] (2 PDB entries)
  8. 1979768Domain d2aczb1: 2acz B:107-238 [126564]
    Other proteins in same PDB: d2aczb2, d2aczc_, d2aczd1
    automated match to d2wdqb2
    complexed with at5, cdn, f3s, fad, fes, heb, oaa, sf4

Details for d2aczb1

PDB Entry: 2acz (more details), 3.1 Å

PDB Description: Complex II (Succinate Dehydrogenase) From E. Coli with Atpenin A5 inhibitor co-crystallized at the ubiquinone binding site
PDB Compounds: (B:) Succinate dehydrogenase iron-sulfur protein

SCOPe Domain Sequences for d2aczb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aczb1 a.1.2.1 (B:107-238) automated matches {Escherichia coli [TaxId: 562]}
mgqfyaqyekikpyllnngqnpparehlqmpeqrekldglyecilcaccstscpsfwwnp
dkfigpagllaayrflidsrdtetdsrldglsdafsvfrchsimncvsvcpkglnptrai
ghiksmllqrna

SCOPe Domain Coordinates for d2aczb1:

Click to download the PDB-style file with coordinates for d2aczb1.
(The format of our PDB-style files is described here.)

Timeline for d2aczb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2aczb2