Lineage for d2aczb1 (2acz B:107-238)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 760029Superfamily a.1.2: alpha-helical ferredoxin [46548] (2 families) (S)
    contains two Fe4-S4 clusters
  5. 760030Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (2 proteins)
  6. 760056Protein Succinate dehydogenase [81669] (1 species)
  7. 760057Species Escherichia coli [TaxId:562] [81670] (3 PDB entries)
  8. 760060Domain d2aczb1: 2acz B:107-238 [126564]
    Other proteins in same PDB: d2aczb2, d2aczc1, d2aczd1
    automatically matched to d1nekb1
    complexed with at5, cdn, f3s, fad, fes, heb, oaa, sf4

Details for d2aczb1

PDB Entry: 2acz (more details), 3.1 Å

PDB Description: Complex II (Succinate Dehydrogenase) From E. Coli with Atpenin A5 inhibitor co-crystallized at the ubiquinone binding site
PDB Compounds: (B:) Succinate dehydrogenase iron-sulfur protein

SCOP Domain Sequences for d2aczb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aczb1 a.1.2.1 (B:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]}
mgqfyaqyekikpyllnngqnpparehlqmpeqrekldglyecilcaccstscpsfwwnp
dkfigpagllaayrflidsrdtetdsrldglsdafsvfrchsimncvsvcpkglnptrai
ghiksmllqrna

SCOP Domain Coordinates for d2aczb1:

Click to download the PDB-style file with coordinates for d2aczb1.
(The format of our PDB-style files is described here.)

Timeline for d2aczb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2aczb2