SCOPe 2.08: Domain d2aczb1: 2acz B:107-238

Lineage for d2aczb1 (2acz B:107-238)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families)
   contains two Fe4-S4 clusters

5. Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)

6. Protein automated matches [231469] (5 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [231470] (2 PDB entries)

8. Domain d2aczb1: 2acz B:107-238 [126564]
   Other proteins in same PDB: d2aczb2, d2aczc_, d2aczd1
   automated match to d2wdqb2
   complexed with at5, cdn, f3s, fad, fes, heb, oaa, sf4

Details for d2aczb1

PDB Entry: 2acz, 3.1 Å

PDB Description: Complex II (Succinate Dehydrogenase) From E. Coli with Atpenin A5 inhibitor co-crystallized at the ubiquinone binding site

PDB Compounds: (B:) Succinate dehydrogenase iron-sulfur protein

SCOPe Domain Sequences for d2aczb1:

Sequence; same for both SEQRES and ATOM records:

>d2aczb1 a.1.2.1 (B:107-238) automated matches {Escherichia coli [TaxId: 562]}
mgqfyaqyekikpyllnngqnpparehlqmpeqrekldglyecilcaccstscpsfwwnp
dkfigpagllaayrflidsrdtetdsrldglsdafsvfrchsimncvsvcpkglnptrai
ghiksmllqrna

Timeline for d2aczb1:

• d2aczb1 first appeared in SCOP 1.73
  
• d2aczb1 appears in SCOPe 2.07