![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) ![]() contains two Fe4-S4 clusters |
![]() | Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins) |
![]() | Protein automated matches [231469] (5 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [231470] (2 PDB entries) |
![]() | Domain d2aczb1: 2acz B:107-238 [126564] Other proteins in same PDB: d2aczb2, d2aczc_, d2aczd1 automated match to d2wdqb2 complexed with at5, cdn, f3s, fad, fes, heb, oaa, sf4 |
PDB Entry: 2acz (more details), 3.1 Å
SCOPe Domain Sequences for d2aczb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aczb1 a.1.2.1 (B:107-238) automated matches {Escherichia coli [TaxId: 562]} mgqfyaqyekikpyllnngqnpparehlqmpeqrekldglyecilcaccstscpsfwwnp dkfigpagllaayrflidsrdtetdsrldglsdafsvfrchsimncvsvcpkglnptrai ghiksmllqrna
Timeline for d2aczb1: