Lineage for d2acpx_ (2acp X:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1799770Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1799771Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1799772Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 1800049Protein Nitrophorin 2 (prolixin-s) [50843] (1 species)
  7. 1800050Species Rhodnius prolixus [TaxId:13249] [50844] (14 PDB entries)
    Uniprot Q26241
  8. 1800057Domain d2acpx_: 2acp X: [126563]
    automated match to d1euoa_
    complexed with hem

Details for d2acpx_

PDB Entry: 2acp (more details), 1.4 Å

PDB Description: Crystal structure of nitrophorin 2 aqua complex
PDB Compounds: (X:) Nitrophorin 2

SCOPe Domain Sequences for d2acpx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2acpx_ b.60.1.1 (X:) Nitrophorin 2 (prolixin-s) {Rhodnius prolixus [TaxId: 13249]}
mdcstnispkqgldkakyfsgkwyvthfldkdpqvtdqycssftpresdgtvkealyhyn
ankktsfynigegklessglqytakyktvdkkkavlkeadeknsytltvleaddssalvh
iclregskdlgdlytvlthqkdaepsakvksavtqaglqlsqfvgtkdlgcqyddqftsl

SCOPe Domain Coordinates for d2acpx_:

Click to download the PDB-style file with coordinates for d2acpx_.
(The format of our PDB-style files is described here.)

Timeline for d2acpx_: