Lineage for d2aclg1 (2acl G:225-457)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 647844Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 647845Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 647846Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (32 proteins)
  6. 648202Protein Retinoid-X receptor alpha (RXR-alpha) [48510] (2 species)
  7. 648203Species Human (Homo sapiens) [TaxId:9606] [48511] (15 PDB entries)
  8. 648232Domain d2aclg1: 2acl G:225-457 [126562]
    automatically matched to d1lbd__
    complexed with l05, rea

Details for d2aclg1

PDB Entry: 2acl (more details), 2.8 Å

PDB Description: Liver X-Receptor alpha Ligand Binding Domain with SB313987
PDB Compounds: (G:) Retinoic acid receptor RXR-alpha

SCOP Domain Sequences for d2aclg1:

Sequence, based on SEQRES records: (download)

>d2aclg1 a.123.1.1 (G:225-457) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
sanedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewak
riphfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvga
ifdrvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayc
khkypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemlea

Sequence, based on observed residues (ATOM records): (download)

>d2aclg1 a.123.1.1 (G:225-457) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
sanedmpverileaelavedpvtnicqaadkqlftlvewakriphfselplddqvillra
gwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvltelvskmrdmqmd
ktelgclraivlfnpdskglsnpaevealrekvyasleayckhkypeqpgrfaklllrlp
alrsiglkclehlfffkligdtpidtflmemlea

SCOP Domain Coordinates for d2aclg1:

Click to download the PDB-style file with coordinates for d2aclg1.
(The format of our PDB-style files is described here.)

Timeline for d2aclg1: