Lineage for d2aclc_ (2acl C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2341330Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2341331Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2341332Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2342369Protein Retinoid-X receptor alpha (RXR-alpha) [48510] (2 species)
  7. 2342370Species Human (Homo sapiens) [TaxId:9606] [48511] (39 PDB entries)
    Uniprot P19793 227-458
  8. 2342409Domain d2aclc_: 2acl C: [126560]
    Other proteins in same PDB: d2aclb1, d2aclb2, d2acld2, d2acld3, d2aclf2, d2aclf3, d2aclh2, d2aclh3
    automated match to d1lbd__
    complexed with l05, rea

Details for d2aclc_

PDB Entry: 2acl (more details), 2.8 Å

PDB Description: Liver X-Receptor alpha Ligand Binding Domain with SB313987
PDB Compounds: (C:) Retinoic acid receptor RXR-alpha

SCOPe Domain Sequences for d2aclc_:

Sequence, based on SEQRES records: (download)

>d2aclc_ a.123.1.1 (C:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
sanedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewak
riphfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvga
ifdrvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayc
khkypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleap

Sequence, based on observed residues (ATOM records): (download)

>d2aclc_ a.123.1.1 (C:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
sanedmpverileaelavedpvtnicqaadkqlftlvewakriphfselplddqvillra
gwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvltelvskmrdmqmd
ktelgclraivlfnpdskglsnpaevealrekvyasleayckhkypeqpgrfaklllrlp
alrsiglkclehlfffkligdtpidtflmemleap

SCOPe Domain Coordinates for d2aclc_:

Click to download the PDB-style file with coordinates for d2aclc_.
(The format of our PDB-style files is described here.)

Timeline for d2aclc_: