Lineage for d2acid1 (2aci D:6-417)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 872041Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 872042Superfamily d.126.1: Pentein [55909] (7 families) (S)
  5. 872072Family d.126.1.4: Arginine deiminase [103232] (1 protein)
    functionally related to the amidinotransferase, similar active sites
  6. 872073Protein Arginine deiminase [103233] (2 species)
  7. 872079Species Pseudomonas aeruginosa [TaxId:287] [103234] (5 PDB entries)
  8. 872095Domain d2acid1: 2aci D:6-417 [126554]
    automatically matched to 2ACI A:6-417
    mutant

Details for d2acid1

PDB Entry: 2aci (more details), 2.5 Å

PDB Description: structure of d166a arginine deiminase
PDB Compounds: (D:) Arginine deiminase

SCOP Domain Sequences for d2acid1:

Sequence, based on SEQRES records: (download)

>d2acid1 d.126.1.4 (D:6-417) Arginine deiminase {Pseudomonas aeruginosa [TaxId: 287]}
tklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvtkmrer
gidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprklaeylig
gvaaddlpaseganilkmyreylghssfllpplpntqftrattcwiyggvtlnpmywpar
rqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligmgerss
rqaigqvaqslfakgaaervivaglpksraamhldtvfsfcdrdlvtvfpevvkeivpfs
lrpdpsspygmnirreektflevvaeslglkklrvvetggnsfaaereqwddgnnvvcle
pgvvvgydrntytntllrkagvevitisaselgrgrggghcmtcpivrdpid

Sequence, based on observed residues (ATOM records): (download)

>d2acid1 d.126.1.4 (D:6-417) Arginine deiminase {Pseudomonas aeruginosa [TaxId: 287]}
tklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvtkmrer
gidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprklaeylig
gvaaddlpaseganilkmyreylghssfllpplpntqftrattcwiyggvtlnpmywpar
rqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligmgerss
rqaigqvaqslfakgaaervivaglpksraamhldtvfsfcdrdlvtvfpevvkeivpfs
lrpdpsspygmnirreektflevvaeslglkklrvvetgreqwddgnnvvclepgvvvgy
drntytntllrkagvevitisaselgrgrggghcmtcpivrdpid

SCOP Domain Coordinates for d2acid1:

Click to download the PDB-style file with coordinates for d2acid1.
(The format of our PDB-style files is described here.)

Timeline for d2acid1: