Lineage for d2acib_ (2aci B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2580827Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 2580828Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 2580865Family d.126.1.4: Arginine deiminase [103232] (1 protein)
    functionally related to the amidinotransferase, similar active sites
  6. 2580866Protein Arginine deiminase [103233] (2 species)
  7. 2580872Species Pseudomonas aeruginosa [TaxId:287] [103234] (5 PDB entries)
  8. 2580886Domain d2acib_: 2aci B: [126552]
    automated match to d1rxxb_

Details for d2acib_

PDB Entry: 2aci (more details), 2.5 Å

PDB Description: structure of d166a arginine deiminase
PDB Compounds: (B:) Arginine deiminase

SCOPe Domain Sequences for d2acib_:

Sequence, based on SEQRES records: (download)

>d2acib_ d.126.1.4 (B:) Arginine deiminase {Pseudomonas aeruginosa [TaxId: 287]}
tklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvtkmrer
gidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprklaeylig
gvaaddlpaseganilkmyreylghssfllpplpntqftrattcwiyggvtlnpmywpar
rqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligmgerss
rqaigqvaqslfakgaaervivaglpksraamhldtvfsfcdrdlvtvfpevvkeivpfs
lrpdpsspygmnirreektflevvaeslglkklrvvetggnsfaaereqwddgnnvvcle
pgvvvgydrntytntllrkagvevitisaselgrgrggghcmtcpivrdpidy

Sequence, based on observed residues (ATOM records): (download)

>d2acib_ d.126.1.4 (B:) Arginine deiminase {Pseudomonas aeruginosa [TaxId: 287]}
tklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvtkmrer
gidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprklaeylig
gvaaddlpaseganilkmyreylghssfllpplpntqftrattcwiyggvtlnpmywpar
rqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligmgerss
rqaigqvaqslfakgaaervivaglpksraamhldtvfsfcdrdlvtvfpevvkeivpfs
lrpdpsspygmnirreektflevvaeslglkklrvvetgaaereqwddgnnvvclepgvv
vgydrntytntllrkagvevitisaselgrgrggghcmtcpivrdpidy

SCOPe Domain Coordinates for d2acib_:

Click to download the PDB-style file with coordinates for d2acib_.
(The format of our PDB-style files is described here.)

Timeline for d2acib_: