SCOPe 2.08: Domain d2acab_: 2aca B:

Lineage for d2acab_ (2aca B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.63: CYTH-like phosphatases [55153] (1 superfamily)
   duplication of beta-alpha-beta(3) motif: antiparallel beta sheet forms wide barrel (n=8, S=16) with a channel running through it

4. Superfamily d.63.1: CYTH-like phosphatases [55154] (3 families)

5. Family d.63.1.2: CYTH domain [118007] (5 proteins)
   Pfam PF01928

6. Protein Putative adenylate cyclase VP1760 [143487] (1 species)

7. Species Vibrio parahaemolyticus [TaxId:670] [143488] (1 PDB entry)
   Uniprot Q87NV8 8-181

8. Domain d2acab_: 2aca B: [126546]
   automated match to d2acaa1
   complexed with po4

Details for d2acab_

PDB Entry: 2aca, 2.25 Å

PDB Description: X-ray structure of a putative adenylate cyclase Q87NV8 from Vibrio parahaemolyticus at the 2.25 A resolution. Northeast Structural Genomics Target VpR19.

PDB Compounds: (B:) putative adenylate cyclase

SCOPe Domain Sequences for d2acab_:

Sequence; same for both SEQRES and ATOM records:

>d2acab_ d.63.1.2 (B:) Putative adenylate cyclase VP1760 {Vibrio parahaemolyticus [TaxId: 670]}
qgqfevelkyrvknhdaflnmvkqiehevmfennqesdwfydtpqrtltqqgkslvlrei
qpagiklwivkgpeadrceatnitkldsaqsmlenmgyeviqcskkirsiffvgefhitl
dfldgfghfaefaimtddetalaryrerlvalaqqfhlseadrehrsykeilsa

Timeline for d2acab_:

• d2acab_ first appeared in SCOP 1.73, called d2acab1
  
• d2acab_ appears in SCOPe 2.07