SCOP 1.73: Domain d2ac7b1: 2ac7 B:2-232

Lineage for d2ac7b1 (2ac7 B:2-232)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (7 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (6 proteins)

6. Protein Purine nucleoside phosphorylase, PNP [53169] (9 species)

7. Species Bacillus anthracis [TaxId:1392] [117655] (2 PDB entries)

8. Domain d2ac7b1: 2ac7 B:2-232 [126544]
   automatically matched to d1xe3d_
   complexed with adn, so4

Details for d2ac7b1

PDB Entry: 2ac7, 1.7 Å

PDB Description: Crystal structure of Adenosine Phosphorylase from Bacillus cereus with adenosine bound in the active site

PDB Compounds: (B:) purine nucleoside phosphorylase

SCOP Domain Sequences for d2ac7b1:

Sequence, based on SEQRES records:

>d2ac7b1 c.56.2.1 (B:2-232) Purine nucleoside phosphorylase, PNP {Bacillus anthracis [TaxId: 1392]}
svhieakqgeiaesillpgdplrakyiaetfledvtcynnvrgmlgftgtykgkrvsvqg
tgmgvpsisiyvneliqsygvknlirvgtcgaiqkdvkvrdviiamtactdsnmnrltfp
gfdfapaanfdllkkaydagtekglhvrvgnvltadvfyresmdmvkklgdygvlaveme
ttalytlaakygvnalsvltvsdhiftgeettseerqttfnemieialdaa

Sequence, based on observed residues (ATOM records):

>d2ac7b1 c.56.2.1 (B:2-232) Purine nucleoside phosphorylase, PNP {Bacillus anthracis [TaxId: 1392]}
svhieakqgeiaesillpgdplrakyiaetfledvtcynnvrgmlgftgtykgkrvsvqg
tgmgvpsisiyvneliqsygvknlirvgtcgaiqkdvkvrdviiamtactdsnmnrltfp
gfdfapaanfdllkkaydagtekglhvrvgnvltadvfyresmdmvkklgdygvlaveme
ttalytlaakygvnalsvltvsdhifqttfnemieialdaa

Timeline for d2ac7b1:

• d2ac7b1 is new in SCOP 1.73
  
• d2ac7b1 appears in SCOP 1.75
  
• d2ac7b1 appears in the current release, SCOPe 2.08, called d2ac7b_