Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (7 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family) complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
Family c.56.2.1: Purine and uridine phosphorylases [53168] (6 proteins) |
Protein Purine nucleoside phosphorylase, PNP [53169] (9 species) |
Species Bacillus anthracis [TaxId:1392] [117655] (2 PDB entries) |
Domain d2ac7b1: 2ac7 B:2-232 [126544] automatically matched to d1xe3d_ complexed with adn, so4 |
PDB Entry: 2ac7 (more details), 1.7 Å
SCOP Domain Sequences for d2ac7b1:
Sequence, based on SEQRES records: (download)
>d2ac7b1 c.56.2.1 (B:2-232) Purine nucleoside phosphorylase, PNP {Bacillus anthracis [TaxId: 1392]} svhieakqgeiaesillpgdplrakyiaetfledvtcynnvrgmlgftgtykgkrvsvqg tgmgvpsisiyvneliqsygvknlirvgtcgaiqkdvkvrdviiamtactdsnmnrltfp gfdfapaanfdllkkaydagtekglhvrvgnvltadvfyresmdmvkklgdygvlaveme ttalytlaakygvnalsvltvsdhiftgeettseerqttfnemieialdaa
>d2ac7b1 c.56.2.1 (B:2-232) Purine nucleoside phosphorylase, PNP {Bacillus anthracis [TaxId: 1392]} svhieakqgeiaesillpgdplrakyiaetfledvtcynnvrgmlgftgtykgkrvsvqg tgmgvpsisiyvneliqsygvknlirvgtcgaiqkdvkvrdviiamtactdsnmnrltfp gfdfapaanfdllkkaydagtekglhvrvgnvltadvfyresmdmvkklgdygvlaveme ttalytlaakygvnalsvltvsdhifqttfnemieialdaa
Timeline for d2ac7b1: