SCOPe 2.08: Domain d2ac7a_: 2ac7 A:

Lineage for d2ac7a_ (2ac7 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)

6. Protein Purine nucleoside phosphorylase, PNP [53169] (14 species)

7. Species Bacillus cereus [TaxId:269801] [186942] (1 PDB entry)

8. Domain d2ac7a_: 2ac7 A: [126543]
   automated match to d1xe3d_
   complexed with adn, so4

Details for d2ac7a_

PDB Entry: 2ac7, 1.7 Å

PDB Description: Crystal structure of Adenosine Phosphorylase from Bacillus cereus with adenosine bound in the active site

PDB Compounds: (A:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d2ac7a_:

Sequence, based on SEQRES records:

>d2ac7a_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Bacillus cereus [TaxId: 269801]}
svhieakqgeiaesillpgdplrakyiaetfledvtcynnvrgmlgftgtykgkrvsvqg
tgmgvpsisiyvneliqsygvknlirvgtcgaiqkdvkvrdviiamtactdsnmnrltfp
gfdfapaanfdllkkaydagtekglhvrvgnvltadvfyresmdmvkklgdygvlaveme
ttalytlaakygvnalsvltvsdhiftgeettseerqttfnemieialdaa

Sequence, based on observed residues (ATOM records):

>d2ac7a_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Bacillus cereus [TaxId: 269801]}
svhieakqgeiaesillpgdplrakyiaetfledvtcynnvrgmlgftgtykgkrvsvqg
tgmgvpsisiyvneliqsygvknlirvgtcgaiqkdvkvrdviiamtactdsnmnrltfp
gfdfapaanfdllkkaydagtekglhvrvgnvltadvfyresmdmvkklgdygvlaveme
ttalytlaakygvnalsvltvsdhiqttfnemieialdaa

Timeline for d2ac7a_:

• d2ac7a_ first appeared in SCOP 1.73, called d2ac7a1
  
• d2ac7a_ appears in SCOPe 2.07