SCOP 1.73: Domain d2ac0d1: 2ac0 D:96-289

Lineage for d2ac0d1 (2ac0 D:96-289)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (7 families)

5. Family b.2.5.2: p53 DNA-binding domain-like [81314] (2 proteins)

6. Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49420] (13 PDB entries)

8. Domain d2ac0d1: 2ac0 D:96-289 [126542]
   automatically matched to d1uola_
   complexed with zn

Details for d2ac0d1

PDB Entry: 2ac0, 1.8 Å

PDB Description: structural basis of dna recognition by p53 tetramers (complex i)

PDB Compounds: (D:) Cellular tumor antigen p53

SCOP Domain Sequences for d2ac0d1:

Sequence; same for both SEQRES and ATOM records:

>d2ac0d1 b.2.5.2 (D:96-289) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
svpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppgt
rvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhs
vvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvc
acpgrdrrteeenl

Timeline for d2ac0d1:

• d2ac0d1 is new in SCOP 1.73
  
• d2ac0d1 appears in SCOP 1.75
  
• d2ac0d1 appears in the current release, SCOPe 2.08, called d2ac0d_