Lineage for d2ac0b1 (2ac0 B:96-289)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 659309Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 659552Superfamily b.2.5: p53-like transcription factors [49417] (7 families) (S)
  5. 659553Family b.2.5.2: p53 DNA-binding domain-like [81314] (2 proteins)
  6. 659554Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)
  7. 659555Species Human (Homo sapiens) [TaxId:9606] [49420] (13 PDB entries)
  8. 659557Domain d2ac0b1: 2ac0 B:96-289 [126540]
    automatically matched to d1uola_
    complexed with zn

Details for d2ac0b1

PDB Entry: 2ac0 (more details), 1.8 Å

PDB Description: structural basis of dna recognition by p53 tetramers (complex i)
PDB Compounds: (B:) Cellular tumor antigen p53

SCOP Domain Sequences for d2ac0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ac0b1 b.2.5.2 (B:96-289) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
svpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppgt
rvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhs
vvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvc
acpgrdrrteeenl

SCOP Domain Coordinates for d2ac0b1:

Click to download the PDB-style file with coordinates for d2ac0b1.
(The format of our PDB-style files is described here.)

Timeline for d2ac0b1: