Class b: All beta proteins [48724] (165 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.5: p53-like transcription factors [49417] (7 families) |
Family b.2.5.2: p53 DNA-binding domain-like [81314] (2 proteins) |
Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [49420] (13 PDB entries) |
Domain d2ac0a1: 2ac0 A:96-289 [126539] automatically matched to d1uola_ complexed with zn |
PDB Entry: 2ac0 (more details), 1.8 Å
SCOP Domain Sequences for d2ac0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ac0a1 b.2.5.2 (A:96-289) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} svpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppgt rvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhs vvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvc acpgrdrrteeenl
Timeline for d2ac0a1: