Lineage for d2abzb_ (2abz B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2125386Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2126724Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2126725Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 protein domains)
  6. 2126726Protein Carboxypeptidase A [53189] (4 species)
  7. 2126729Species Cow (Bos taurus) [TaxId:9913] [53190] (34 PDB entries)
  8. 2126773Domain d2abzb_: 2abz B: [126538]
    Other proteins in same PDB: d2abzc1, d2abzd_, d2abze_, d2abzf_
    automated match to d1pytb_
    complexed with zn; mutant

Details for d2abzb_

PDB Entry: 2abz (more details), 2.16 Å

PDB Description: Crystal structure of C19A/C43A mutant of leech carboxypeptidase inhibitor in complex with bovine carboxypeptidase A
PDB Compounds: (B:) Carboxypeptidase A1

SCOPe Domain Sequences for d2abzb_:

Sequence, based on SEQRES records: (download)

>d2abzb_ c.56.5.1 (B:) Carboxypeptidase A {Cow (Bos taurus) [TaxId: 9913]}
stntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrpai
widlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafthsq
nrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksivdf
vkdhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsykygs
iittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvltime
htv

Sequence, based on observed residues (ATOM records): (download)

>d2abzb_ c.56.5.1 (B:) Carboxypeptidase A {Cow (Bos taurus) [TaxId: 9913]}
stntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrpai
widlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafthsq
nrlwrktrsvtslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksivdfvk
dhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsykygsii
ttiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvltimeht
v

SCOPe Domain Coordinates for d2abzb_:

Click to download the PDB-style file with coordinates for d2abzb_.
(The format of our PDB-style files is described here.)

Timeline for d2abzb_: