Lineage for d2abza1 (2abz A:4-305)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 702659Fold c.56: Phosphorylase/hydrolase-like [53162] (7 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 703083Superfamily c.56.5: Zn-dependent exopeptidases [53187] (8 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 703084Family c.56.5.1: Pancreatic carboxypeptidases [53188] (4 proteins)
  6. 703085Protein Carboxypeptidase A [53189] (4 species)
  7. 703088Species Cow (Bos taurus) [TaxId:9913] [53190] (27 PDB entries)
  8. 703117Domain d2abza1: 2abz A:4-305 [126537]
    automatically matched to d1arl__
    complexed with zn; mutant

Details for d2abza1

PDB Entry: 2abz (more details), 2.16 Å

PDB Description: Crystal structure of C19A/C43A mutant of leech carboxypeptidase inhibitor in complex with bovine carboxypeptidase A
PDB Compounds: (A:) Carboxypeptidase A1

SCOP Domain Sequences for d2abza1:

Sequence, based on SEQRES records: (download)

>d2abza1 c.56.5.1 (A:4-305) Carboxypeptidase A {Cow (Bos taurus) [TaxId: 9913]}
tntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrpaiw
idlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafthsqn
rlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksivdfv
kdhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsykygsi
ittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvltimeh
tv

Sequence, based on observed residues (ATOM records): (download)

>d2abza1 c.56.5.1 (A:4-305) Carboxypeptidase A {Cow (Bos taurus) [TaxId: 9913]}
tntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrpaiw
idlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafthsqn
rlwrktrsvslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksivdfvkdh
gnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsykygsiitt
iyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvltimehtv

SCOP Domain Coordinates for d2abza1:

Click to download the PDB-style file with coordinates for d2abza1.
(The format of our PDB-style files is described here.)

Timeline for d2abza1: