Lineage for d2abwb1 (2abw B:2-219)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 692818Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (8 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 692819Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (11 proteins)
    contains a catalytic Cys-His-Glu triad
  6. 692933Protein Pyridoxine biosynthesis protein 2, Pdx2 [142068] (1 species)
  7. 692934Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [142069] (1 PDB entry)
  8. 692936Domain d2abwb1: 2abw B:2-219 [126536]
    automatically matched to 2ABW A:2-219
    complexed with pg4

Details for d2abwb1

PDB Entry: 2abw (more details), 1.62 Å

PDB Description: glutaminase subunit of the plasmodial plp synthase (vitamin b6 biosynthesis)
PDB Compounds: (B:) Pdx2 protein

SCOP Domain Sequences for d2abwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2abwb1 c.23.16.1 (B:2-219) Pyridoxine biosynthesis protein 2, Pdx2 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
seitigvlslqgdfephinhfiklqipslniiqvrnvhdlglcdglvipggesttvrrcc
ayendtlynalvhfihvlkkpiwgtcagcillsknveniklysnfgnkfsfgglditicr
nfygsqndsficslniisdssafkkdltaacirapyireilsdevkvlatfshesygpni
iaaveqnnclgtvfhpellphtafqqyfyekvknykys

SCOP Domain Coordinates for d2abwb1:

Click to download the PDB-style file with coordinates for d2abwb1.
(The format of our PDB-style files is described here.)

Timeline for d2abwb1: