SCOPe 2.08: Domain d2abwb2: 2abw B:2-219

Lineage for d2abwb2 (2abw B:2-219)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.0: automated matches [191336] (1 protein)
   not a true family

6. Protein automated matches [190197] (23 species)
   not a true protein

7. Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [186940] (1 PDB entry)

8. Domain d2abwb2: 2abw B:2-219 [126536]
   Other proteins in same PDB: d2abwa1, d2abwa2, d2abwb3
   automated match to d1q7ra_
   complexed with pg4

Details for d2abwb2

PDB Entry: 2abw, 1.62 Å

PDB Description: glutaminase subunit of the plasmodial plp synthase (vitamin b6 biosynthesis)

PDB Compounds: (B:) Pdx2 protein

SCOPe Domain Sequences for d2abwb2:

Sequence; same for both SEQRES and ATOM records:

>d2abwb2 c.23.16.0 (B:2-219) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
seitigvlslqgdfephinhfiklqipslniiqvrnvhdlglcdglvipggesttvrrcc
ayendtlynalvhfihvlkkpiwgtcagcillsknveniklysnfgnkfsfgglditicr
nfygsqndsficslniisdssafkkdltaacirapyireilsdevkvlatfshesygpni
iaaveqnnclgtvfhpellphtafqqyfyekvknykys

Timeline for d2abwb2:

• d2abwb2 first appeared in SCOP 1.73, called d2abwb1
  
• d2abwb2 appears in SCOPe 2.07