Lineage for d2abrd_ (2abr D:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1668076Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 1668077Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 1668111Family d.126.1.4: Arginine deiminase [103232] (1 protein)
    functionally related to the amidinotransferase, similar active sites
  6. 1668112Protein Arginine deiminase [103233] (2 species)
  7. 1668118Species Pseudomonas aeruginosa [TaxId:287] [103234] (5 PDB entries)
  8. 1668138Domain d2abrd_: 2abr D: [126533]
    automated match to d1rxxb_

Details for d2abrd_

PDB Entry: 2abr (more details), 2.9 Å

PDB Description: structure of d280a arginine deiminase with l-arginine forming a s- alkylthiouronium reaction intermediate
PDB Compounds: (D:) Arginine deiminase

SCOPe Domain Sequences for d2abrd_:

Sequence, based on SEQRES records: (download)

>d2abrd_ d.126.1.4 (D:) Arginine deiminase {Pseudomonas aeruginosa [TaxId: 287]}
tklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvtkmrer
gidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprklaeylig
gvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtlnpmywpar
rqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligmgerss
rqaigqvaqslfakgaaervivaglpksraamhlatvfsfcdrdlvtvfpevvkeivpfs
lrpdpsspygmnirreektflevvaeslglkklrvvetggnsfaaereqwddgnnvvcle
pgvvvgydrntytntllrkagvevitisaselgrgrggghcmtcpivrdpi

Sequence, based on observed residues (ATOM records): (download)

>d2abrd_ d.126.1.4 (D:) Arginine deiminase {Pseudomonas aeruginosa [TaxId: 287]}
tklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvtkmrer
gidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprklaeylig
gvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtlnpmywpar
rqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligmgerss
rqaigqvaqslfakgaaervivaglpksrmhlatvfsfcdrdlvtvfpevvkeivpfslr
pdpsspygmnirreektflevvaeslglkklrvvetgreqwddgnnvvclepgvvvgydr
ntytntllrkagvevitisaselgrgrggghcmtcpivrdpi

SCOPe Domain Coordinates for d2abrd_:

Click to download the PDB-style file with coordinates for d2abrd_.
(The format of our PDB-style files is described here.)

Timeline for d2abrd_: