Lineage for d2abqb_ (2abq B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2511779Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2511780Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2511781Family c.72.1.1: Ribokinase-like [53614] (10 proteins)
    automatically mapped to Pfam PF00294
  6. 2511909Protein automated matches [190470] (2 species)
    not a true protein
  7. 2511910Species Bacillus halodurans [TaxId:86665] [187390] (1 PDB entry)
  8. 2511911Domain d2abqb_: 2abq B: [126529]
    Other proteins in same PDB: d2abqa1
    automated match to d2abqa1
    complexed with po4

Details for d2abqb_

PDB Entry: 2abq (more details), 2.1 Å

PDB Description: crystal structure of fructose-1-phosphate kinase from bacillus halodurans
PDB Compounds: (B:) fructose 1-phosphate kinase

SCOPe Domain Sequences for d2abqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2abqb_ c.72.1.1 (B:) automated matches {Bacillus halodurans [TaxId: 86665]}
miytvtlnpsidyivqvenfqqgvvnrserdrkqpggkginvsrvlkrlghetkalgflg
gftgayvrnalekeeiglsfievegdtrinvkikgkqetelngtaplikkehvqalleql
telekgdvlvlagsvpqampqtiyrsmtqiakergafvavdtsgealhevlaakpsfikp
nhhelselvskpiasiedaiphvqrligegiesilvsfagdgalfasaegmfhvnvpsge
vrnsvgagdsvvagflaalqegksledavpfavaagsatafsdgfctreeverlqqqlqr
tikkeg

SCOPe Domain Coordinates for d2abqb_:

Click to download the PDB-style file with coordinates for d2abqb_.
(The format of our PDB-style files is described here.)

Timeline for d2abqb_: