Lineage for d2aboa1 (2abo A:6-136)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 744528Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 744568Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (1 family) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 744569Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (10 proteins)
    Pfam PF00452
  6. 744614Protein Bcl-2 homolog V-bcl-2 [144081] (1 species)
  7. 744615Species Murid herpesvirus 4 [TaxId:33708] [144082] (1 PDB entry)
  8. 744616Domain d2aboa1: 2abo A:6-136 [126527]

Details for d2aboa1

PDB Entry: 2abo (more details)

PDB Description: nmr structure of gamma herpesvirus 68 a viral bcl-2 homolog
PDB Compounds: (A:) bcl-2 homolog

SCOP Domain Sequences for d2aboa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aboa1 f.1.4.1 (A:6-136) Bcl-2 homolog V-bcl-2 {Murid herpesvirus 4 [TaxId: 33708]}
sgtywatlitaflktvskveeldcvdsavlvdvskiitltqefrrhydsvyradygpalk
nwkrdlsklftslfvdvinsgrivgffdvgryvceevlcpgswtedhellndcmthffie
nnlmnhfpled

SCOP Domain Coordinates for d2aboa1:

Click to download the PDB-style file with coordinates for d2aboa1.
(The format of our PDB-style files is described here.)

Timeline for d2aboa1: