Lineage for d2abmg1 (2abm G:1-227)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 745358Fold f.19: Aquaporin-like [81339] (1 superfamily)
    core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helices
  4. 745359Superfamily f.19.1: Aquaporin-like [81338] (1 family) (S)
  5. 745360Family f.19.1.1: Aquaporin-like [56895] (4 proteins)
    duplication: consist of two similar structural parts
  6. 745361Protein Aquaporin Z [103470] (1 species)
  7. 745362Species Escherichia coli [TaxId:562] [103471] (2 PDB entries)
  8. 745371Domain d2abmg1: 2abm G:1-227 [126525]
    automatically matched to d1rc2a_
    complexed with 3pg, aga, bgl, pee, po4, poq

Details for d2abmg1

PDB Entry: 2abm (more details), 3.2 Å

PDB Description: crystal structure of aquaporin z tetramer reveals both open and closed water-conducting channels
PDB Compounds: (G:) Aquaporin Z

SCOP Domain Sequences for d2abmg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2abmg1 f.19.1.1 (G:1-227) Aquaporin Z {Escherichia coli [TaxId: 562]}
mfrklaaecfgtfwlvfggcgsavlaagfpelgigfagvalafgltvltmafavghisgg
hfnpavtiglwaggrfpakevvgyviaqvvggivaaallyliasgktgfdaaasgfasng
ygehspggysmlsalvvelvlsagfllvihgatdkfapagfapiaiglaltlihlisipv
tntsvnparstavaifqggwaleqlwffwvvpivggiiggliyrtll

SCOP Domain Coordinates for d2abmg1:

Click to download the PDB-style file with coordinates for d2abmg1.
(The format of our PDB-style files is described here.)

Timeline for d2abmg1: