Class f: Membrane and cell surface proteins and peptides [56835] (50 folds) |
Fold f.19: Aquaporin-like [81339] (1 superfamily) core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helices |
Superfamily f.19.1: Aquaporin-like [81338] (1 family) |
Family f.19.1.1: Aquaporin-like [56895] (4 proteins) duplication: consist of two similar structural parts |
Protein Aquaporin Z [103470] (1 species) |
Species Escherichia coli [TaxId:562] [103471] (2 PDB entries) |
Domain d2abmg1: 2abm G:1-227 [126525] automatically matched to d1rc2a_ complexed with 3pg, aga, bgl, pee, po4, poq |
PDB Entry: 2abm (more details), 3.2 Å
SCOP Domain Sequences for d2abmg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2abmg1 f.19.1.1 (G:1-227) Aquaporin Z {Escherichia coli [TaxId: 562]} mfrklaaecfgtfwlvfggcgsavlaagfpelgigfagvalafgltvltmafavghisgg hfnpavtiglwaggrfpakevvgyviaqvvggivaaallyliasgktgfdaaasgfasng ygehspggysmlsalvvelvlsagfllvihgatdkfapagfapiaiglaltlihlisipv tntsvnparstavaifqggwaleqlwffwvvpivggiiggliyrtll
Timeline for d2abmg1: