Lineage for d2abmc1 (2abm C:1-227)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629731Fold f.19: Aquaporin-like [81339] (1 superfamily)
    core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helices
  4. 2629732Superfamily f.19.1: Aquaporin-like [81338] (2 families) (S)
  5. 2629733Family f.19.1.1: Aquaporin-like [56895] (5 proteins)
    duplication: consist of two similar structural parts
    automatically mapped to Pfam PF00230
  6. 2629734Protein Aquaporin Z [103470] (1 species)
  7. 2629735Species Escherichia coli [TaxId:562] [103471] (6 PDB entries)
  8. 2629746Domain d2abmc1: 2abm C:1-227 [126521]
    automatically matched to d1rc2a_
    complexed with 3pg, aga, bgl, pee, po4, poq

Details for d2abmc1

PDB Entry: 2abm (more details), 3.2 Å

PDB Description: crystal structure of aquaporin z tetramer reveals both open and closed water-conducting channels
PDB Compounds: (C:) Aquaporin Z

SCOPe Domain Sequences for d2abmc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2abmc1 f.19.1.1 (C:1-227) Aquaporin Z {Escherichia coli [TaxId: 562]}
mfrklaaecfgtfwlvfggcgsavlaagfpelgigfagvalafgltvltmafavghisgg
hfnpavtiglwaggrfpakevvgyviaqvvggivaaallyliasgktgfdaaasgfasng
ygehspggysmlsalvvelvlsagfllvihgatdkfapagfapiaiglaltlihlisipv
tntsvnparstavaifqggwaleqlwffwvvpivggiiggliyrtll

SCOPe Domain Coordinates for d2abmc1:

Click to download the PDB-style file with coordinates for d2abmc1.
(The format of our PDB-style files is described here.)

Timeline for d2abmc1: