Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.19: Aquaporin-like [81339] (1 superfamily) core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helices |
Superfamily f.19.1: Aquaporin-like [81338] (2 families) |
Family f.19.1.1: Aquaporin-like [56895] (5 proteins) duplication: consist of two similar structural parts automatically mapped to Pfam PF00230 |
Protein Aquaporin Z [103470] (1 species) |
Species Escherichia coli [TaxId:562] [103471] (6 PDB entries) |
Domain d2abmc1: 2abm C:1-227 [126521] automatically matched to d1rc2a_ complexed with 3pg, aga, bgl, pee, po4, poq |
PDB Entry: 2abm (more details), 3.2 Å
SCOPe Domain Sequences for d2abmc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2abmc1 f.19.1.1 (C:1-227) Aquaporin Z {Escherichia coli [TaxId: 562]} mfrklaaecfgtfwlvfggcgsavlaagfpelgigfagvalafgltvltmafavghisgg hfnpavtiglwaggrfpakevvgyviaqvvggivaaallyliasgktgfdaaasgfasng ygehspggysmlsalvvelvlsagfllvihgatdkfapagfapiaiglaltlihlisipv tntsvnparstavaifqggwaleqlwffwvvpivggiiggliyrtll
Timeline for d2abmc1: