SCOP 1.73: Domain d2abba1: 2abb A:4-364

Lineage for d2abba1 (2abb A:4-364)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family)

5. Family c.1.4.1: FMN-linked oxidoreductases [51396] (18 proteins)

6. Protein Pentaerythritol tetranirate reductase [63900] (1 species)

7. Species Enterobacter cloacae [TaxId:550] [63901] (15 PDB entries)

8. Domain d2abba1: 2abb A:4-364 [126517]
   complexed with fmn, ipr, scn; mutant

Details for d2abba1

PDB Entry: 2abb, 1 Å

PDB Description: structure of petn reductase y186f in complex with cyanide

PDB Compounds: (A:) Pentaerythritol tetranitrate reductase

SCOP Domain Sequences for d2abba1:

Sequence; same for both SEQRES and ATOM records:

>d2abba1 c.1.4.1 (A:4-364) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]}
klftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatqisa
qakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqapvsas
alnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvelhsa
hgfllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtfqnv
dngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviigagay
taekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytdyps
l

Timeline for d2abba1:

• d2abba1 is new in SCOP 1.73
  
• d2abba1 appears in SCOP 1.75
  
• d2abba1 appears in the current release, SCOPe 2.08