Lineage for d2abaa1 (2aba A:3-364)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 681629Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family) (S)
  5. 681630Family c.1.4.1: FMN-linked oxidoreductases [51396] (18 proteins)
  6. 681829Protein Pentaerythritol tetranirate reductase [63900] (1 species)
  7. 681830Species Enterobacter cloacae [TaxId:550] [63901] (15 PDB entries)
  8. 681833Domain d2abaa1: 2aba A:3-364 [126516]
    automatically matched to d1gvra_
    complexed with fmn, ipr, str

Details for d2abaa1

PDB Entry: 2aba (more details), 1.05 Å

PDB Description: Structure of reduced PETN reductase in complex with progesterone
PDB Compounds: (A:) Pentaerythritol tetranitrate reductase

SCOP Domain Sequences for d2abaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2abaa1 c.1.4.1 (A:3-364) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]}
eklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatqis
aqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqapvsa
salnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvelhs
ahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtfqn
vdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviigaga
ytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytdyp
sl

SCOP Domain Coordinates for d2abaa1:

Click to download the PDB-style file with coordinates for d2abaa1.
(The format of our PDB-style files is described here.)

Timeline for d2abaa1: