Lineage for d2ab6d2 (2ab6 D:1-84)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698982Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 698983Superfamily c.47.1: Thioredoxin-like [52833] (22 families) (S)
  5. 699243Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 699397Protein Class mu GST [81359] (3 species)
  7. 699405Species Human (Homo sapiens) [TaxId:9606] [52867] (15 PDB entries)
  8. 699434Domain d2ab6d2: 2ab6 D:1-84 [126514]
    Other proteins in same PDB: d2ab6a1, d2ab6b1, d2ab6c1, d2ab6d1
    automatically matched to d1hna_2
    complexed with gsm

Details for d2ab6d2

PDB Entry: 2ab6 (more details), 2.5 Å

PDB Description: human glutathione s-transferase m2-2 (e.c.2.5.1.18) complexed with s- methylglutathione
PDB Compounds: (D:) Glutathione S-transferase Mu 2

SCOP Domain Sequences for d2ab6d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ab6d2 c.47.1.5 (D:1-84) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgthkitqsnailryiarkhn

SCOP Domain Coordinates for d2ab6d2:

Click to download the PDB-style file with coordinates for d2ab6d2.
(The format of our PDB-style files is described here.)

Timeline for d2ab6d2: