SCOP 1.73: Domain d2ab6c1: 2ab6 C:85-217

Lineage for d2ab6c1 (2ab6 C:85-217)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class mu GST [81348] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47622] (15 PDB entries)

8. Domain d2ab6c1: 2ab6 C:85-217 [126511]
   Other proteins in same PDB: d2ab6a2, d2ab6b2, d2ab6c2, d2ab6d2
   automatically matched to d1hna_1
   complexed with gsm

Details for d2ab6c1

PDB Entry: 2ab6, 2.5 Å

PDB Description: human glutathione s-transferase m2-2 (e.c.2.5.1.18) complexed with s- methylglutathione

PDB Compounds: (C:) Glutathione S-transferase Mu 2

SCOP Domain Sequences for d2ab6c1:

Sequence; same for both SEQRES and ATOM records:

>d2ab6c1 a.45.1.1 (C:85-217) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
lcgesekeqiredilenqfmdsrmqlaklcydpdfeklkpeylqalpemlklysqflgkq
pwflgdkitfvdfiaydvlernqvfepscldafpnlkdfisrfeglekisaymkssrflp
rpvftkmavwgnk

Timeline for d2ab6c1:

• d2ab6c1 is new in SCOP 1.73
  
• d2ab6c1 appears in SCOP 1.75
  
• d2ab6c1 appears in the current release, SCOPe 2.08