SCOPe 2.08: Domain d2ab4a2: 2ab4 A:1-228

Lineage for d2ab4a2 (2ab4 A:1-228)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
   consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold

4. Superfamily d.265.1: Pseudouridine synthase [55120] (5 families)
   the active site is the most conserved structural region of the superfamily and is located between the subdomains

5. Family d.265.1.2: Pseudouridine synthase II TruB [69746] (2 proteins)
   contains C-terminal PUA domain

6. Protein Pseudouridine synthase II TruB [69747] (5 species)

7. Species Thermotoga maritima [TaxId:2336] [103016] (4 PDB entries)

8. Domain d2ab4a2: 2ab4 A:1-228 [126506]
   Other proteins in same PDB: d2ab4a1
   protein/RNA complex; complexed with zn

Details for d2ab4a2

PDB Entry: 2ab4, 2.4 Å

PDB Description: dissecting the roles of a strictly conserved tyrosine in substrate recognition and catalysis by pseudouridine 55 synthase

PDB Compounds: (A:) tRNA pseudouridine synthase B

SCOPe Domain Sequences for d2ab4a2:

Sequence; same for both SEQRES and ATOM records:

>d2ab4a2 d.265.1.2 (A:1-228) Pseudouridine synthase II TruB {Thermotoga maritima [TaxId: 2336]}
mkhgilvaykpkgptshdvvdevrkklktrkvghggtldpfacgvliigvnqgtrilefy
kdlkkvfwvkmrlglitetfditgevveerecnvteeeireaifsfvgeydqvppaysak
kykgerlyklaregkiinlppkrvkifkiwdvniegrdvsfrvevspgtyirslcmdigy
klgcgatavelvresvgphtieeslnvfeaapeeienriiplekclew

Timeline for d2ab4a2:

• d2ab4a2 first appeared in SCOP 1.73
  
• d2ab4a2 appears in SCOPe 2.07