Lineage for d2ab4a1 (2ab4 A:229-308)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 680324Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 680325Superfamily b.122.1: PUA domain-like [88697] (10 families) (S)
  5. 680326Family b.122.1.1: PUA domain [88698] (5 proteins)
    RNA-binding domain
  6. 680349Protein Pseudouridine synthase II TruB, C-terminal domain [88699] (5 species)
  7. 680363Species Thermotoga maritima [TaxId:2336] [102023] (4 PDB entries)
  8. 680365Domain d2ab4a1: 2ab4 A:229-308 [126505]
    Other proteins in same PDB: d2ab4a2
    complexed with fhu, zn; mutant

Details for d2ab4a1

PDB Entry: 2ab4 (more details), 2.4 Å

PDB Description: Dissecting the Roles of a Strictly Conserved Tyrosine in Substrate Recognition and Catalysis by Pseudouridine 55 Synthase
PDB Compounds: (A:) tRNA pseudouridine synthase B

SCOP Domain Sequences for d2ab4a1:

Sequence, based on SEQRES records: (download)

>d2ab4a1 b.122.1.1 (A:229-308) Pseudouridine synthase II TruB, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
lprvvvhqestkmilngsqihlemlkewdgfkkgevvrvfneegrllalaeaernssfle
tlrkherqervltlrkvfqt

Sequence, based on observed residues (ATOM records): (download)

>d2ab4a1 b.122.1.1 (A:229-308) Pseudouridine synthase II TruB, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
lprvvvhqestkmilngsqihlemlkewdgfkkgevvrvfneegrllalaeaernssfrq
ervltlrkvfqt

SCOP Domain Coordinates for d2ab4a1:

Click to download the PDB-style file with coordinates for d2ab4a1.
(The format of our PDB-style files is described here.)

Timeline for d2ab4a1: