SCOPe 2.08: Domain d2ab4a1: 2ab4 A:229-308

Lineage for d2ab4a1 (2ab4 A:229-308)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (15 families)

5. Family b.122.1.1: PUA domain [88698] (6 proteins)
   RNA-binding domain

6. Protein Pseudouridine synthase II TruB, C-terminal domain [88699] (5 species)

7. Species Thermotoga maritima [TaxId:2336] [102023] (4 PDB entries)

8. Domain d2ab4a1: 2ab4 A:229-308 [126505]
   Other proteins in same PDB: d2ab4a2
   protein/RNA complex; complexed with zn

Details for d2ab4a1

PDB Entry: 2ab4, 2.4 Å

PDB Description: dissecting the roles of a strictly conserved tyrosine in substrate recognition and catalysis by pseudouridine 55 synthase

PDB Compounds: (A:) tRNA pseudouridine synthase B

SCOPe Domain Sequences for d2ab4a1:

Sequence, based on SEQRES records:

>d2ab4a1 b.122.1.1 (A:229-308) Pseudouridine synthase II TruB, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
lprvvvhqestkmilngsqihlemlkewdgfkkgevvrvfneegrllalaeaernssfle
tlrkherqervltlrkvfqt

Sequence, based on observed residues (ATOM records):

>d2ab4a1 b.122.1.1 (A:229-308) Pseudouridine synthase II TruB, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
lprvvvhqestkmilngsqihlemlkewdgfkkgevvrvfneegrllalaeaernssfrq
ervltlrkvfqt

Timeline for d2ab4a1:

• d2ab4a1 first appeared in SCOP 1.73
  
• d2ab4a1 appears in SCOPe 2.07