Lineage for d2ab1b1 (2ab1 B:2-122)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 712110Fold c.103: MTH938-like [64075] (1 superfamily)
    core: 3 layers, b+a/b/a ; the central mixed sheet of 5 strands: order 21534; strand 2 is antiparallel to the rest
  4. 712111Superfamily c.103.1: MTH938-like [64076] (1 family) (S)
  5. 712112Family c.103.1.1: MTH938-like [64077] (5 proteins)
  6. 712123Protein Hypothetical protein PTD015 (C11orf67) [142443] (1 species)
  7. 712124Species Human (Homo sapiens) [TaxId:9606] [142444] (2 PDB entries)
  8. 712126Domain d2ab1b1: 2ab1 B:2-122 [126504]
    automatically matched to 2AB1 A:2-122

Details for d2ab1b1

PDB Entry: 2ab1 (more details), 2.59 Å

PDB Description: x-ray structure of gene product from homo sapiens hs.95870
PDB Compounds: (B:) hypothetical protein

SCOP Domain Sequences for d2ab1b1:

Sequence, based on SEQRES records: (download)

>d2ab1b1 c.103.1.1 (B:2-122) Hypothetical protein PTD015 (C11orf67) {Human (Homo sapiens) [TaxId: 9606]}
tspeiaslswgqmkvkgsnttykdckvwpggsrtwdwretgtehspgvqpadvkevvekg
vqtlvigrgmsealkvpsstveylkkhgidvrvlqteqavkeynalvaqgvrvggvfhst
c

Sequence, based on observed residues (ATOM records): (download)

>d2ab1b1 c.103.1.1 (B:2-122) Hypothetical protein PTD015 (C11orf67) {Human (Homo sapiens) [TaxId: 9606]}
tspeiaslswgqmkvkgsnttykdckvwpggsrtwdgvqpadvkevvekgvqtlvigrgm
sealkvpsstveylkkhgidvrvlqteqavkeynalvaqgvrvggvfhstc

SCOP Domain Coordinates for d2ab1b1:

Click to download the PDB-style file with coordinates for d2ab1b1.
(The format of our PDB-style files is described here.)

Timeline for d2ab1b1: