![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.103: MTH938-like [64075] (1 superfamily) core: 3 layers, b+a/b/a ; the central mixed sheet of 5 strands: order 21534; strand 2 is antiparallel to the rest |
![]() | Superfamily c.103.1: MTH938-like [64076] (1 family) ![]() |
![]() | Family c.103.1.1: MTH938-like [64077] (5 proteins) |
![]() | Protein Hypothetical protein PTD015 (C11orf67) [142443] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [142444] (2 PDB entries) |
![]() | Domain d2ab1b1: 2ab1 B:2-122 [126504] automatically matched to 2AB1 A:2-122 |
PDB Entry: 2ab1 (more details), 2.59 Å
SCOP Domain Sequences for d2ab1b1:
Sequence, based on SEQRES records: (download)
>d2ab1b1 c.103.1.1 (B:2-122) Hypothetical protein PTD015 (C11orf67) {Human (Homo sapiens) [TaxId: 9606]} tspeiaslswgqmkvkgsnttykdckvwpggsrtwdwretgtehspgvqpadvkevvekg vqtlvigrgmsealkvpsstveylkkhgidvrvlqteqavkeynalvaqgvrvggvfhst c
>d2ab1b1 c.103.1.1 (B:2-122) Hypothetical protein PTD015 (C11orf67) {Human (Homo sapiens) [TaxId: 9606]} tspeiaslswgqmkvkgsnttykdckvwpggsrtwdgvqpadvkevvekgvqtlvigrgm sealkvpsstveylkkhgidvrvlqteqavkeynalvaqgvrvggvfhstc
Timeline for d2ab1b1: