SCOPe 2.04: Domain d2ab0b_: 2ab0 B:

Lineage for d2ab0b_ (2ab0 B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.0: automated matches [191336] (1 protein)
   not a true family

6. Protein automated matches [190197] (15 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [186939] (6 PDB entries)

8. Domain d2ab0b_: 2ab0 B: [126502]
   Other proteins in same PDB: d2ab0a1
   automated match to d1j42a_

Details for d2ab0b_

PDB Entry: 2ab0, 1.1 Å

PDB Description: Crystal Structure of E. coli protein YajL (ThiJ)

PDB Compounds: (B:) YajL

SCOPe Domain Sequences for d2ab0b_:

Sequence; same for both SEQRES and ATOM records:

>d2ab0b_ c.23.16.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
sasalvclapgseeteavttidllvrggikvttasvasdgnlaitcsrgvklladaplve
vadgeydvivlpggikgaecfrdstllvetvkqfhrsgrivaaicaapatvlvphdifpi
gnmtgfptlkdkipaeqwldkrvvwdarvklltsqgpgtaidfglkiidllvgrekahev
asqlvmaagiynyye

Timeline for d2ab0b_:

• d2ab0b_ first appeared in SCOP 1.73, called d2ab0b1
  
• d2ab0b_ appears in SCOPe 2.03
  
• d2ab0b_ appears in SCOPe 2.05
  
• d2ab0b_ appears in the current release, SCOPe 2.08