SCOP 1.73: Domain d2ab0b1: 2ab0 B:2-196

Lineage for d2ab0b1 (2ab0 B:2-196)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (8 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.2: DJ-1/PfpI [52325] (9 proteins)
   contains a catalytic triad or dyad different from the class I GAT triad

6. Protein Protein ThiJ (YajL) [142070] (1 species)

7. Species Escherichia coli [TaxId:562] [142071] (1 PDB entry)

8. Domain d2ab0b1: 2ab0 B:2-196 [126502]
   automatically matched to 2AB0 A:2-196

Details for d2ab0b1

PDB Entry: 2ab0, 1.1 Å

PDB Description: Crystal Structure of E. coli protein YajL (ThiJ)

PDB Compounds: (B:) YajL

SCOP Domain Sequences for d2ab0b1:

Sequence; same for both SEQRES and ATOM records:

>d2ab0b1 c.23.16.2 (B:2-196) Protein ThiJ (YajL) {Escherichia coli [TaxId: 562]}
sasalvclapgseeteavttidllvrggikvttasvasdgnlaitcsrgvklladaplve
vadgeydvivlpggikgaecfrdstllvetvkqfhrsgrivaaicaapatvlvphdifpi
gnmtgfptlkdkipaeqwldkrvvwdarvklltsqgpgtaidfglkiidllvgrekahev
asqlvmaagiynyye

Timeline for d2ab0b1:

• d2ab0b1 is new in SCOP 1.73
  
• d2ab0b1 appears in SCOP 1.75
  
• d2ab0b1 appears in the current release, SCOPe 2.08, called d2ab0b_