Lineage for d2aaya1 (2aay A:1-427)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 726532Fold d.68: IF3-like [55199] (7 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 726542Superfamily d.68.2: EPT/RTPC-like [55205] (2 families) (S)
  5. 726552Family d.68.2.2: Enolpyruvate transferase, EPT [55209] (2 proteins)
    duplication: 6 repeats of this fold are organized in two RPTC-like domains
  6. 726553Protein 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase [55213] (2 species)
  7. 726554Species Escherichia coli [TaxId:562] [55214] (11 PDB entries)
  8. 726558Domain d2aaya1: 2aay A:1-427 [126500]
    automatically matched to d1g6sa_
    complexed with fmt, gpj, skm

Details for d2aaya1

PDB Entry: 2aay (more details), 1.55 Å

PDB Description: epsp synthase liganded with shikimate and glyphosate
PDB Compounds: (A:) 3-phosphoshikimate 1-carboxyvinyltransferase

SCOP Domain Sequences for d2aaya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aaya1 d.68.2.2 (A:1-427) 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase {Escherichia coli [TaxId: 562]}
mesltlqpiarvdgtinlpgsksvsnralllaalahgktvltnlldsddvrhmlnaltal
gvsytlsadrtrceiignggplhaegalelflgnagtamrplaaalclgsndivltgepr
mkerpighlvdalrlggakityleqenypplrlqggftggnvdvdgsvssqfltallmta
plapedtvirikgdlvskpyiditlnlmktfgveienqhyqqfvvkggqsyqspgtylve
gdassasyflaaaaikggtvkvtgigrnsmqgdirfadvlekmgaticwgddyisctrge
lnaidmdmnhipdaamtiataalfakgtttlrniynwrvketdrlfamatelrkvgaeve
eghdyiritppeklnfaeiatyndhrmamcfslvalsdtpvtildpkctaktfpdyfeql
arisqaa

SCOP Domain Coordinates for d2aaya1:

Click to download the PDB-style file with coordinates for d2aaya1.
(The format of our PDB-style files is described here.)

Timeline for d2aaya1: