SCOP 1.73: Domain d2aawa2: 2aaw A:1-85

Lineage for d2aawa2 (2aaw A:1-85)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (22 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)

6. Protein Pf GST [102442] (1 species)
   cannot be assigned to any of the known GST classes

7. Species Malarial parasite (Plasmodium falciparum) [TaxId:5833] [102443] (4 PDB entries)

8. Domain d2aawa2: 2aaw A:1-85 [126497]
   Other proteins in same PDB: d2aawa1, d2aawc1
   automatically matched to d1okta2
   complexed with dtl, gtx, p33

Details for d2aawa2

PDB Entry: 2aaw, 2.4 Å

PDB Description: studies on ligand binding and enzyme inhibition of plasmodium falciparum glutathione s-transferase

PDB Compounds: (A:) glutathione s-transferase

SCOP Domain Sequences for d2aawa2:

Sequence; same for both SEQRES and ATOM records:

>d2aawa2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]}
mgdnivlyyfdargkaelirlifaylgieytdkrfgvngdafvefknfkkekdtpfeqvp
ilqigdlilaqsqaivrylskkyni

Timeline for d2aawa2:

• d2aawa2 is new in SCOP 1.73
  
• d2aawa2 appears in SCOP 1.75
  
• d2aawa2 appears in the current release, SCOPe 2.08