SCOP 1.75: Domain d2aawa1: 2aaw A:86-211

Lineage for d2aawa1 (2aaw A:86-211)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Pf GST [101210] (1 species)
   cannot be assigned to any of the known GST classes

7. Species Malarial parasite (Plasmodium falciparum) [TaxId:5833] [101211] (4 PDB entries)

8. Domain d2aawa1: 2aaw A:86-211 [126496]
   Other proteins in same PDB: d2aawa2, d2aawc2
   automatically matched to d1okta1
   complexed with dtl, gtx, p33

Details for d2aawa1

PDB Entry: 2aaw, 2.4 Å

PDB Description: studies on ligand binding and enzyme inhibition of plasmodium falciparum glutathione s-transferase

PDB Compounds: (A:) glutathione s-transferase

SCOP Domain Sequences for d2aawa1:

Sequence, based on SEQRES records:

>d2aawa1 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]}
cgeselnefyadmifcgvqdihykfnntnlfkqnettflnedlpkwsgyfekllkknhtn
nnndkyyfvgnnltyadlavfnlyddietkypsslknfpllkahnefisnlpniknyitn
rkesvy

Sequence, based on observed residues (ATOM records):

>d2aawa1 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]}
cgeselnefyadmifcgvqdihykfnntnlfkqnettflnedlpkwsgyfekllkknhky
yfvgnnltyadlavfnlyddietkypsslknfpllkahnefisnlpniknyitnrkesvy

Timeline for d2aawa1:

• d2aawa1 first appeared in SCOP 1.73
  
• d2aawa1 appears in SCOPe 2.01
  
• d2aawa1 appears in the current release, SCOPe 2.08