SCOPe 2.06: Domain d2aamc_: 2aam C:

Lineage for d2aamc_ (2aam C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.15: TM1410-like [141796] (1 protein)
   Pfam PF03537

6. Protein Hypothetical protein TM1410 [141797] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [141798] (1 PDB entry)
   Uniprot Q9X1D0 28-312

8. Domain d2aamc_: 2aam C: [126491]
   automated match to d2aama1
   complexed with gol, unl

Details for d2aamc_

PDB Entry: 2aam, 2.2 Å

PDB Description: Crystal structure of a putative glycosidase (tm1410) from thermotoga maritima at 2.20 A resolution

PDB Compounds: (C:) Hypothetical protein TM1410

SCOPe Domain Sequences for d2aamc_:

Sequence; same for both SEQRES and ATOM records:

>d2aamc_ c.1.8.15 (C:) Hypothetical protein TM1410 {Thermotoga maritima [TaxId: 2336]}
tegwfmpfdnwlyqlqnadpveisssgfeiavidyskdgsesgeyspeeikimvdagvvp
vayvnigqaedyrfywkeswytntpewlgeedpawpgnyfvkywynewkeivfsyldrvi
dqgfkgiyldridsfeywaqegvisrrsaarkminfvleiaeyvrerkpdmliipqngen
ildfddgqlastvsgwavenlfylktipleenetksrleylirlnrkgkfilsvdyvddg
sdsfenisrildyyekakrngcipyaarsdleldemnviegiqppe

Timeline for d2aamc_:

• d2aamc_ first appeared in SCOP 1.73, called d2aamc1
  
• d2aamc_ appears in SCOPe 2.05
  
• d2aamc_ appears in SCOPe 2.07
  
• d2aamc_ appears in the current release, SCOPe 2.08