Lineage for d2aajb_ (2aaj B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2567390Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 2567391Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 2568058Family d.80.1.6: MSAD-like [143532] (1 protein)
  6. 2568059Protein Malonate semialdehyde decarboxylase, MSAD [143533] (1 species)
  7. 2568060Species Pseudomonas pavonaceae [TaxId:47881] [143534] (3 PDB entries)
    Uniprot Q9EV83 2-130! Uniprot Q9EV83 2-230
  8. 2568074Domain d2aajb_: 2aaj B: [126482]
    automated match to d2aaja1
    mutant

Details for d2aajb_

PDB Entry: 2aaj (more details), 2.74 Å

PDB Description: crystal structures of the wild-type, mutant-p1a and inactivated malonate semialdehyde decarboxylase: a structural basis for the decarboxylase and hydratase activities
PDB Compounds: (B:) Malonate Semialdehyde Decarboxylase

SCOPe Domain Sequences for d2aajb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aajb_ d.80.1.6 (B:) Malonate semialdehyde decarboxylase, MSAD {Pseudomonas pavonaceae [TaxId: 47881]}
allkfdlfygrtdaqikslldaahgamvdafgvpandryqtvsqhrpgemvledtglgyg
rssavvlltvisrprsesqkvcfyklltgalerdcgispddvivalvensdadwsfgrgr
aefltgdlv

SCOPe Domain Coordinates for d2aajb_:

Click to download the PDB-style file with coordinates for d2aajb_.
(The format of our PDB-style files is described here.)

Timeline for d2aajb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2aaja1