SCOPe 2.06: Domain d2aajb_: 2aaj B:

Lineage for d2aajb_ (2aaj B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
   (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
   generally forms trimers with three closely packed beta-sheets

4. Superfamily d.80.1: Tautomerase/MIF [55331] (7 families)

5. Family d.80.1.6: MSAD-like [143532] (1 protein)

6. Protein Malonate semialdehyde decarboxylase, MSAD [143533] (1 species)

7. Species Pseudomonas pavonaceae [TaxId:47881] [143534] (3 PDB entries)
   Uniprot Q9EV83 2-130! Uniprot Q9EV83 2-230

8. Domain d2aajb_: 2aaj B: [126482]
   automated match to d2aaja1
   mutant

Details for d2aajb_

PDB Entry: 2aaj, 2.74 Å

PDB Description: crystal structures of the wild-type, mutant-p1a and inactivated malonate semialdehyde decarboxylase: a structural basis for the decarboxylase and hydratase activities

PDB Compounds: (B:) Malonate Semialdehyde Decarboxylase

SCOPe Domain Sequences for d2aajb_:

Sequence; same for both SEQRES and ATOM records:

>d2aajb_ d.80.1.6 (B:) Malonate semialdehyde decarboxylase, MSAD {Pseudomonas pavonaceae [TaxId: 47881]}
allkfdlfygrtdaqikslldaahgamvdafgvpandryqtvsqhrpgemvledtglgyg
rssavvlltvisrprsesqkvcfyklltgalerdcgispddvivalvensdadwsfgrgr
aefltgdlv

Timeline for d2aajb_:

• d2aajb_ first appeared in SCOP 1.73, called d2aajb1
  
• d2aajb_ appears in SCOPe 2.05
  
• d2aajb_ appears in SCOPe 2.07
  
• d2aajb_ appears in the current release, SCOPe 2.08