Lineage for d2aaja1 (2aaj A:1-129)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 727709Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 727710Superfamily d.80.1: Tautomerase/MIF [55331] (6 families) (S)
  5. 727871Family d.80.1.6: MSAD-like [143532] (1 protein)
  6. 727872Protein Malonate semialdehyde decarboxylase, MSAD [143533] (1 species)
  7. 727873Species Pseudomonas pavonaceae [TaxId:47881] [143534] (3 PDB entries)
  8. 727886Domain d2aaja1: 2aaj A:1-129 [126481]
    mutant

Details for d2aaja1

PDB Entry: 2aaj (more details), 2.74 Å

PDB Description: Crystal Structures of the Wild-type, Mutant-P1A and Inactivated Malonate Semialdehyde Decarboxylase: A Structural Basis for the Decarboxylase and Hydratase Activities
PDB Compounds: (A:) Malonate Semialdehyde Decarboxylase

SCOP Domain Sequences for d2aaja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aaja1 d.80.1.6 (A:1-129) Malonate semialdehyde decarboxylase, MSAD {Pseudomonas pavonaceae [TaxId: 47881]}
allkfdlfygrtdaqikslldaahgamvdafgvpandryqtvsqhrpgemvledtglgyg
rssavvlltvisrprsesqkvcfyklltgalerdcgispddvivalvensdadwsfgrgr
aefltgdlv

SCOP Domain Coordinates for d2aaja1:

Click to download the PDB-style file with coordinates for d2aaja1.
(The format of our PDB-style files is described here.)

Timeline for d2aaja1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2aajb1