SCOP 1.73: Domain d2aagc1: 2aag C:1-129

Lineage for d2aagc1 (2aag C:1-129)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
   (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
   generally forms trimers with three closely packed beta-sheets

4. Superfamily d.80.1: Tautomerase/MIF [55331] (6 families)

5. Family d.80.1.6: MSAD-like [143532] (1 protein)

6. Protein Malonate semialdehyde decarboxylase, MSAD [143533] (1 species)

7. Species Pseudomonas pavonaceae [TaxId:47881] [143534] (3 PDB entries)

8. Domain d2aagc1: 2aag C:1-129 [126477]
   automatically matched to 2AAL A:1-129
   mutant

Details for d2aagc1

PDB Entry: 2aag, 1.85 Å

PDB Description: crystal structures of the wild-type, mutant-p1a and inactivated malonate semialdehyde decarboxylase: a structural basis for the decarboxylase and hydratase activities

PDB Compounds: (C:) Malonate Semialdehyde Decarboxylase

SCOP Domain Sequences for d2aagc1:

Sequence; same for both SEQRES and ATOM records:

>d2aagc1 d.80.1.6 (C:1-129) Malonate semialdehyde decarboxylase, MSAD {Pseudomonas pavonaceae [TaxId: 47881]}
pllkfdlfygrtdaqikslldaahgamvdafgvpandryqtvsqhrpgemvledtglgyg
rssavvlltvisrprseeqkvcfyklltgalerdcgispddvivalvensdadwsfgrgr
aefltgdlv

Timeline for d2aagc1:

• d2aagc1 is new in SCOP 1.73
  
• d2aagc1 appears in SCOP 1.75
  
• d2aagc1 appears in the current release, SCOPe 2.08, called d2aagc_