Lineage for d2aafd_ (2aaf D:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1217588Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 1217589Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 1217623Family d.126.1.4: Arginine deiminase [103232] (1 protein)
    functionally related to the amidinotransferase, similar active sites
  6. 1217624Protein Arginine deiminase [103233] (2 species)
  7. 1217630Species Pseudomonas aeruginosa [TaxId:287] [103234] (5 PDB entries)
  8. 1217638Domain d2aafd_: 2aaf D: [126474]
    automated match to d1rxxb_

Details for d2aafd_

PDB Entry: 2aaf (more details), 2.3 Å

PDB Description: structure of h278a arginine deiminase with l-arginine forming a s- alkylthiouronium reaction intermediate
PDB Compounds: (D:) Arginine deiminase

SCOPe Domain Sequences for d2aafd_:

Sequence, based on SEQRES records: (download)

>d2aafd_ d.126.1.4 (D:) Arginine deiminase {Pseudomonas aeruginosa [TaxId: 287]}
tklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvtkmrer
gidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprklaeylig
gvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtlnpmywpar
rqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligmgerss
rqaigqvaqslfakgaaervivaglpksraamaldtvfsfcdrdlvtvfpevvkeivpfs
lrpdpsspygmnirreektflevvaeslglkklrvvetggnsfaaereqwddgnnvvcle
pgvvvgydrntytntllrkagvevitisaselgrgrggghcmtcpivrdpidy

Sequence, based on observed residues (ATOM records): (download)

>d2aafd_ d.126.1.4 (D:) Arginine deiminase {Pseudomonas aeruginosa [TaxId: 287]}
tklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvtkmrer
gidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprklaeylig
gvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtlnpmywpar
rqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligmgerss
rqaigqvaqslfakgaaervivaglpksraamaldtvfsfcdrdlvtvfpevvkeivpfs
lrpdpsspygmnirreektflevvaeslglkklrvvetgreqwddgnnvvclepgvvvgy
drntytntllrkagvevitisaselgrgrggghcmtcpivrdpidy

SCOPe Domain Coordinates for d2aafd_:

Click to download the PDB-style file with coordinates for d2aafd_.
(The format of our PDB-style files is described here.)

Timeline for d2aafd_: