Lineage for d2aafa1 (2aaf A:6-417)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 872041Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 872042Superfamily d.126.1: Pentein [55909] (7 families) (S)
  5. 872072Family d.126.1.4: Arginine deiminase [103232] (1 protein)
    functionally related to the amidinotransferase, similar active sites
  6. 872073Protein Arginine deiminase [103233] (2 species)
  7. 872079Species Pseudomonas aeruginosa [TaxId:287] [103234] (5 PDB entries)
  8. 872088Domain d2aafa1: 2aaf A:6-417 [126471]
    complexed with cyr; mutant

Details for d2aafa1

PDB Entry: 2aaf (more details), 2.3 Å

PDB Description: structure of h278a arginine deiminase with l-arginine forming a s- alkylthiouronium reaction intermediate
PDB Compounds: (A:) Arginine deiminase

SCOP Domain Sequences for d2aafa1:

Sequence, based on SEQRES records: (download)

>d2aafa1 d.126.1.4 (A:6-417) Arginine deiminase {Pseudomonas aeruginosa [TaxId: 287]}
tklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvtkmrer
gidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprklaeylig
gvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtlnpmywpar
rqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligmgerss
rqaigqvaqslfakgaaervivaglpksraamaldtvfsfcdrdlvtvfpevvkeivpfs
lrpdpsspygmnirreektflevvaeslglkklrvvetggnsfaaereqwddgnnvvcle
pgvvvgydrntytntllrkagvevitisaselgrgrggghcmtcpivrdpid

Sequence, based on observed residues (ATOM records): (download)

>d2aafa1 d.126.1.4 (A:6-417) Arginine deiminase {Pseudomonas aeruginosa [TaxId: 287]}
tklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvtkmrer
gidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprklaeylig
gvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtlnpmywpar
rqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligmgerss
rqaigqvaqslfakgaaervivaglpksraamaldtvfsfcdrdlvtvfpevvkeivpfs
lrpdpsspygmnirreektflevvaeslglkklrvvetgreqwddgnnvvclepgvvvgy
drntytntllrkagvevitisaselgrgrggghcmtcpivrdpid

SCOP Domain Coordinates for d2aafa1:

Click to download the PDB-style file with coordinates for d2aafa1.
(The format of our PDB-style files is described here.)

Timeline for d2aafa1: