SCOPe 2.08: Domain d2aa4b1: 2aa4 B:1-119

Lineage for d2aa4b1 (2aa4 B:1-119)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.10: ROK [110636] (8 proteins)
   Pfam PF00480

6. Protein N-acetylmannosamine kinase NanK [142471] (1 species)

7. Species Escherichia coli [TaxId:562] [142472] (1 PDB entry)
   Uniprot P45425 1-119! Uniprot P45425 120-289

8. Domain d2aa4b1: 2aa4 B:1-119 [126467]
   automated match to d2aa4a1
   complexed with zn

Details for d2aa4b1

PDB Entry: 2aa4, 2.2 Å

PDB Description: crystal structure of escherichia coli putative n-acetylmannosamine kinase, new york structural genomics consortium

PDB Compounds: (B:) Putative N-acetylmannosamine kinase

SCOPe Domain Sequences for d2aa4b1:

Sequence; same for both SEQRES and ATOM records:

>d2aa4b1 c.55.1.10 (B:1-119) N-acetylmannosamine kinase NanK {Escherichia coli [TaxId: 562]}
mttlaidiggtklaaaligadgqirdrrelptpasqtpealrdalsalvsplqahaqrva
iastgiirdgsllalnphnlggllhfplvktleqltnlptiaindaqaaawaefqaldg

Timeline for d2aa4b1:

• d2aa4b1 first appeared in SCOP 1.73
  
• d2aa4b1 appears in SCOPe 2.07