Lineage for d2aa1a1 (2aa1 A:1-142)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 758373Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 758539Protein Hemoglobin, alpha-chain [46486] (20 species)
  7. 758544Species Antarctic fish (Trematomus newnesi) [TaxId:35730] [46497] (4 PDB entries)
  8. 758546Domain d2aa1a1: 2aa1 A:1-142 [126463]
    Other proteins in same PDB: d2aa1b1, d2aa1d1
    automatically matched to d1la6a_
    complexed with ace, hem

Details for d2aa1a1

PDB Entry: 2aa1 (more details), 1.8 Å

PDB Description: Crystal structure of the cathodic hemoglobin isolated from the Antarctic fish Trematomus Newnesi
PDB Compounds: (A:) Hemoglobin alpha-1 chain

SCOP Domain Sequences for d2aa1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aa1a1 a.1.1.2 (A:1-142) Hemoglobin, alpha-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}
slsdkdkaavralwskigkssdaigndalsrmivvypqtkiyfshwpdvtpgspnikahg
kkvmggialavskiddlktglmelseqhayklrvdpsnfkilnhcilvvistmfpkeftp
eahvsldkflsgvalalaeryr

SCOP Domain Coordinates for d2aa1a1:

Click to download the PDB-style file with coordinates for d2aa1a1.
(The format of our PDB-style files is described here.)

Timeline for d2aa1a1: