Lineage for d2aa0a1 (2aa0 A:10-359)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 707937Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 707938Superfamily c.72.1: Ribokinase-like [53613] (5 families) (S)
    has extra strand located between strands 2 and 3
  5. 707939Family c.72.1.1: Ribokinase-like [53614] (9 proteins)
  6. 707959Protein Adenosine kinase [53617] (2 species)
  7. 707966Species Toxoplasma gondii [TaxId:5811] [53619] (10 PDB entries)
  8. 707971Domain d2aa0a1: 2aa0 A:10-359 [126462]
    automatically matched to 2ABS A:10-359
    complexed with act, cl, mtp, na; mutant

Details for d2aa0a1

PDB Entry: 2aa0 (more details), 1.75 Å

PDB Description: Crystal structure of T. gondii adenosine kinase complexed with 6-methylmercaptopurine riboside
PDB Compounds: (A:) adenosine kinase

SCOP Domain Sequences for d2aa0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aa0a1 c.72.1.1 (A:10-359) Adenosine kinase {Toxoplasma gondii [TaxId: 5811]}
tgpmrvfaignpildlvaevpssfldefflkrgdatlatpeqmriystldqfnptslpgg
salnsvrvvqkllrkpgsagymgaigddprgqvlkelcdkeglatrfmvapgqstgvcav
linekertlcthlgacgsfrlpedwttfasgalifyataytltatpknalevagyahgip
naiftlnlsapfcvelykdamqslllhtnilfgneeefahlakvhnlvaaektalstank
ehavevctgalrlltagqntsatklvvmtrghnpviaaeqtadgtvvvhevgvpvvaaek
ivdtngagdafvggflyalsqgktvkqcimcgnacaqdviqhvgfslsft

SCOP Domain Coordinates for d2aa0a1:

Click to download the PDB-style file with coordinates for d2aa0a1.
(The format of our PDB-style files is described here.)

Timeline for d2aa0a1: