Lineage for d2a9za_ (2a9z A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2154413Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2154414Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2154415Family c.72.1.1: Ribokinase-like [53614] (10 proteins)
    automatically mapped to Pfam PF00294
  6. 2154437Protein Adenosine kinase [53617] (3 species)
  7. 2154452Species Toxoplasma gondii [TaxId:5811] [53619] (13 PDB entries)
  8. 2154455Domain d2a9za_: 2a9z A: [126461]
    automated match to d2absa1
    complexed with 26a, acp, cl, na

Details for d2a9za_

PDB Entry: 2a9z (more details), 1.35 Å

PDB Description: crystal structure of t. gondii adenosine kinase complexed with n6- dimethyladenosine and amp-pcp
PDB Compounds: (A:) adenosine kinase

SCOPe Domain Sequences for d2a9za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a9za_ c.72.1.1 (A:) Adenosine kinase {Toxoplasma gondii [TaxId: 5811]}
tgpmrvfaignpildlvaevpssfldefflkrgdatlatpeqmriystldqfnptslpgg
salnsvrvvqkllrkpgsagymgaigddprgqvlkelcdkeglatrfmvapgqstgvcav
linekertlcthlgacgsfrlpedwttfasgalifyataytltatpknalevagyahgip
naiftlnlsapfcvelykdamqslllhtnilfgneeefahlakvhnlvaaektalstank
ehavevctgalrlltagqntsatklvvmtrghnpviaaeqtadgtvvvhevgvpvvaaek
ivdtngagdafvggflyalsqgktvkqcimcgnacaqdviqhvgfslsftf

SCOPe Domain Coordinates for d2a9za_:

Click to download the PDB-style file with coordinates for d2a9za_.
(The format of our PDB-style files is described here.)

Timeline for d2a9za_: