Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.1: Ribokinase-like [53613] (6 families) has extra strand located between strands 2 and 3 |
Family c.72.1.1: Ribokinase-like [53614] (10 proteins) automatically mapped to Pfam PF00294 |
Protein Adenosine kinase [53617] (2 species) |
Species Toxoplasma gondii [TaxId:5811] [53619] (10 PDB entries) |
Domain d2a9ya_: 2a9y A: [126460] automated match to d2absa1 complexed with 26a, act, cl, na |
PDB Entry: 2a9y (more details), 1.35 Å
SCOPe Domain Sequences for d2a9ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a9ya_ c.72.1.1 (A:) Adenosine kinase {Toxoplasma gondii [TaxId: 5811]} tgpmrvfaignpildlvaevpssfldefflkrgdatlatpeqmriystldqfnptslpgg salnsvrvvqkllrkpgsagymgaigddprgqvlkelcdkeglatrfmvapgqstgvcav linekertlcthlgacgsfrlpedwttfasgalifyataytltatpknalevagyahgip naiftlnlsapfcvelykdamqslllhtnilfgneeefahlakvhnlvaaektalstank ehavevctgalrlltagqntsatklvvmtrghnpviaaeqtadgtvvvhevgvpvvaaek ivdtngagdafvggflyalsqgktvkqcimcgnacaqdviqhvgfslsftf
Timeline for d2a9ya_: